• 0Shopping Cart
EnCor Biotechnology
  • Home
  • About
    • Story of EnCor
    • Our Philosophy
    • Location
    • Jobs
  • Our Products
    • Mouse Monoclonal Antibodies
    • Rabbit Polyclonal Antibodies
    • Chicken Polyclonal Antibodies
    • Epitope Mapped Antibodies
    • Goat Polyclonal Antibodies
    • IHC Verified Antibodies
    • ELISA Kits
    • Pure Proteins
    • Posters
  • Links
    • On-Line Data
    • Poster Gallery
    • Programs
    • Protocols
    • Collaborators
    • Catalog Download
    • Distributors
    • Funding
    • Ordering
  • News
    • 2023 News
    • 2022 ARCHIVE
    • 2021 ARCHIVE
    • 2020 ARCHIVE
    • 2019 ARCHIVE
    • 2018 ARCHIVE
    • 2017 ARCHIVE
    • 2016 ARCHIVE
    • 2015 ARCHIVE
    • 2014 ARCHIVE
    • 2013 ARCHIVE
    • 2012 ARCHIVE
    • 2011 ARCHIVE
    • ARCHIVE PRE 2011

Human MAP2 Projection P3
Cat# Prot-r-MAP2A/B-P3

$300.00 – $2,000.00Price range: $300.00 through $2,000.00

      Microtubule associated protein 2 or MAP2 is a major microtubule binding protein of neurons, where it is concentrated in dendrites and perikarya but absent from axons. There is a single mammalian MAP2 gene which may generate multiple lower molecular weight forms usually named MAP2C and MAP2D which run on SDS-PAGE gels at 60-70kDa, though are actually much smaller in molecular size. These forms are found early in development but as the animal matures are replaced by MAP2A and B which are much larger in molecular size. These two forms include the so-called projection domain, a long insert which results in both molecules running at ~240kDa on SDS-PAGE gels. We have expressed five different recombinant forms of MAP2 based on the human sequence reported in REFSEQ XP_006712595.. These constructs in combination cover almost the entire human MAP2 molecule.

Clear
SKU: prot-r-map2a-b-p3 Categories: ELISA Standard, Pure Protein, Recombinant Protein
  • Overview
  • Background
  • References
Name: Recombinant human MAP2A/B protein construct 3
HGNC Name: HGNC:6839
RRID: Pending
Format:
Applications:
Storage:
Uniprot: P11137

      Microtubule associated protein 2 or MAP2 is a major microtubule binding protein of neurons, where it is concentrated in dendrites and perikarya but absent from axons (1). There is a single mammalian MAP2 gene which may generate multiple lower molecular weight forms usually named MAP2C and MAP2D which run on SDS-PAGE gels at 60-70kDa, though are actually much smaller in molecular size. These forms are found early in development but as the animal matures are replaced by MAP2A and B which are much larger in molecular size. These two forms include the so-called projection domain, a long insert which results in both molecules running at ~240kDa on SDS-PAGE gels. All four forms contain an N-terminal region which includes a binding site of cAMP dependent protein kinase (1). We have expressed five different recombinant forms of MAP2 based on the human sequence reported in REFSEQ XP_006712595.. These constructs in combination cover almost the entire human MAP2 molecule. We have used these constructs to generate a series of monoclonal and polyclonal antibodies to MAP2, many of which are known to recognize defined segments of MAP2.

      The sequence is amino acids 1137-1538 from REFSEQ XP_006712595. This corresponds to the the third segment of the “projection domain” found in MAP2A and MAP2B but missing from MAP2C and MAP2D. The construct was expressed in pET29a and has a few N and C-terminal amino acids derived from the vector, including a C-terminal His-tag.

>MAP2-P3
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVS

1. Dehmelt1, H and Halpain, S. The MAP2/Tau family of microtubule-associated proteins.
Genome Biol. 204 (2005).

Related products

  • Human MAP2C Protein
    Cat# Prot-r-MAP2C

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Recombinant Human Peripherin
    Cat# Prot-r-Peri

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Recombinant ACE2 SARS-CoV2 Binding Domain

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Purified Bovine GFAP protein
    Cat# Prot-m-GFAP-bov

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page

Contact info

EnCor Biotechnology Inc.
4949 SW 41st Boulevard, Ste 40
Gainesville
Florida 32608 USA

Phone: (352) 372 7022
Fax: (352) 372 7066
E-mail: [email protected]

Cart

RSS News

© Copyright - EnCor Biotechnology 2023.
  • Facebook
  • Rss
  • Linkedin
  • Twitter
Human MAP2 Projection P2
Cat# Prot-r-MAP2A/B-P2
Mouse Monoclonal Antibody to Human Ki67, Ki-67
Cat# MCA-6G3
Scroll to top