• 0Shopping Cart
EnCor Biotechnology
  • Home
  • About
    • Story of EnCor
    • Our Philosophy
    • Location
    • Jobs
  • Our Products
    • Mouse Monoclonal Antibodies
    • Rabbit Polyclonal Antibodies
    • Chicken Polyclonal Antibodies
    • Epitope Mapped Antibodies
    • Goat Polyclonal Antibodies
    • IHC Verified Antibodies
    • ELISA Kits
    • Pure Proteins
    • Posters
  • Links
    • On-Line Data
    • Poster Gallery
    • Programs
    • Protocols
    • Collaborators
    • Catalog Download
    • Distributors
    • Funding
    • Ordering
  • News
    • 2023 News
    • 2022 ARCHIVE
    • 2021 ARCHIVE
    • 2020 ARCHIVE
    • 2019 ARCHIVE
    • 2018 ARCHIVE
    • 2017 ARCHIVE
    • 2016 ARCHIVE
    • 2015 ARCHIVE
    • 2014 ARCHIVE
    • 2013 ARCHIVE
    • 2012 ARCHIVE
    • 2011 ARCHIVE
    • ARCHIVE PRE 2011

Human MAP2C Protein
Cat# Prot-r-MAP2C

$300.00 – $2,000.00Price range: $300.00 through $2,000.00

      Microtubule associated protein 2 or MAP2 is a major microtubule binding protein of neurons, where it is concentrated in dendrites and perikarya but absent from axons. There is a single mammalian MAP2 gene which may generate multiple lower molecular weight forms usually named MAP2C and MAP2D which run on SDS-PAGE gels at 60-70kDa, though are actually much smaller in molecular size. These forms are found early in development but as the animal matures are replaced by MAP2A and B which are much larger in molecular size. These two forms include the so-called projection domain, a long insert which results in both molecules running at ~240kDa on SDS-PAGE gels. We have expressed five different recombinant forms of MAP2 based on the human sequence which in combination cover almost the entire human MAP2 molecule.

Clear
SKU: prot-r-map2c Categories: ELISA Standard, Pure Protein, Recombinant Protein
  • Overview
  • Overview
  • Background
  • References

      The first lane shows molecular weight standards of the indicated apparent molecular weights in kiloDaltons. The next 5 lanes show 2µg amounts of purified recombinant forms of various human MAP2 proteins. D is recombinant full length MAP2D and C is recombinant full length MAP2C. MAP2D is 559 amino acids while MAP2C is 471, missing one of the microtubule binding domains of MAP2D and a more N-terminal 57 amino acid N-terminal sequence. Lanes P1, P2 and P3 show each recombinant segments of the human MAP2 projection domain, found in MAP2A and B but absent from MAP2C and D. The P1 construct is amino acids 233-684, the P2 is 712-1136 and P3 is 1137-1588. All of the constructs run more slowly on SDS-PAGE than expected from their molecular size, probably due to their high content of charged amino acids. These constructs were used to make a series of mouse monoclonal antibodies. The lane marked BSA contains 2µg of bovine serum albumin, another gel standard.

Name: Recombinant human MAP2C
HGNC Name: MAP2
RRID: Pending
Format: 1mg/mL in 6M Urea
Applications:
Storage:
Uniprot: P11137

      Microtubule associated protein 2 or MAP2 is a major microtubule binding protein of neurons, where it is concentrated in dendrites and perikarya but absent from axons (1). There is a single mammalian MAP2 gene which may generate multiple lower molecular weight forms usually named MAP2C and MAP2D which run on SDS-PAGE gels at 60-70kDa, though are actually much smaller in molecular size. These forms are found early in development but as the animal matures are replaced by MAP2A and B which are much larger in molecular size. These two forms include the so-called projection domain, a long insert which results in both molecules running at ~240kDa on SDS-PAGE gels. All four forms contain an N-terminal region which includes a binding site of cAMP dependent protein kinase (1).  We have expressed five different recombinant forms of MAP2 based on the human sequence reported in REFSEQ XP_006712595.. These constructs in combination cover almost the entire human MAP2 molecule. We have used these constructs to generate a series of monoclonal and polyclonal antibodies to MAP2, many of which are known to recognize defined segments of MAP2.

      We inserted cDNAs encoding the various MAP2 sequences into the pET29a eukaryotic expression vector. The vector adds an C-terminal His-tag which was use to purify the protein and this, along with some other vector derived sequence, adds about 5 kDa to the molecule.

      The sequence is from REFSEQ XP_006712595. This is the shortest transcript of the human MAP2 gene, including only 3 of the C-terminal microtubule binding domains. The construct was expressed in pET29a and has a few N and C-terminal amino acids derived from the vector, including a C-terminal His-tag.

>MAP2C
MADERKDEAKAPHWTSAPLTEASAHSHPPEIKDQGGAGEGLVRSANGFPYREDEEGAFGE
HGSQGTYSNTKENGINGELTSADRETAEEVSARIVQVVTAEAVAVLKGEQEKEAQHKDQT
AALPLAAEETANLPPSPPPSPASEQTVTVEEAAGGESALAPSVFKQAKDKVSDGVTKSPE
KRSSLPRPSSILPPRRGVSGDRDENSFSLNSSISSSARRTTRSEPIRRAGKSGTSTPTTP
GSTAITPGTPPSYSSRTPGTPGTPSYPRTPHTPGTPKSAILVPSEKKVAIIRTPPKSPAT
PKQLRLINQPLPDLKNVKSKIGSTDNIKYQPKGGQVQIVTKKIDLSHVTSKCGSLKNIRH
RPGGGRVKIESVKLDFKEKAQAKVGSLDNAHHVPGGGNVKIDSQKLNFREHAKARVDHGA
EIITQSPGRSSVASPRRLSNVSSSGSINLLESPQLATLAEDVTAALAKQGL

 

1. Dehmelt1, H and Halpain, S. The MAP2/Tau family of microtubule-associated proteins.
Genome Biol. 204 (2005)

Related products

  • Human MAP2 Projection P1
    PROT-r-MAP2A/B-P1

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Recombinant mCherry Protein
    Cat# Prot-r-mCherry

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Purified Bovine Neurofilament NF-H
    Prot-m-NF-H

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Recombinant Human NF-L Standard
    Cat# PROT-r-NF-L-Stan

    $300.00 – $2,000.00Price range: $300.00 through $2,000.00
    Select options This product has multiple variants. The options may be chosen on the product page

Contact info

EnCor Biotechnology Inc.
4949 SW 41st Boulevard, Ste 40
Gainesville
Florida 32608 USA

Phone: (352) 372 7022
Fax: (352) 372 7066
E-mail: [email protected]

Recently Viewed Products

  • Mouse Monoclonal Antibody to MAP2A/B/C/D Cat# MCA-2C4 Mouse Monoclonal Antibody to MAP2A/B/C/D Cat# MCA-2C4 $120.00 – $800.00Price range: $120.00 through $800.00
  • Mouse Monoclonal Antibody to Doublecortin <br>Cat# MCA-3E1 Mouse Monoclonal Antibody to Doublecortin
    Cat# MCA-3E1
    $120.00 – $800.00Price range: $120.00 through $800.00
  • Mouse Monoclonal Antibody to Calreticulin <br>Cat# MCA-6C6 Mouse Monoclonal Antibody to Calreticulin
    Cat# MCA-6C6
    $120.00 – $800.00Price range: $120.00 through $800.00

Cart

RSS News

© Copyright - EnCor Biotechnology 2023.
  • Facebook
  • Rss
  • Linkedin
  • Twitter
Poster #18 Human MAP2 Projection P1
PROT-r-MAP2A/B-P1
Scroll to top