• 0Shopping Cart
EnCor Biotechnology
  • Home
  • About
    • Story of EnCor
    • Our Philosophy
    • Location
    • Jobs
  • Our Products
    • Mouse Monoclonal Antibodies
    • Rabbit Polyclonal Antibodies
    • Chicken Polyclonal Antibodies
    • Epitope Mapped Antibodies
    • Goat Polyclonal Antibodies
    • IHC Verified Antibodies
    • ELISA Kits
    • Pure Proteins
    • Posters
  • Links
    • On-Line Data
    • Poster Gallery
    • Programs
    • Protocols
    • Collaborators
    • Catalog Download
    • Distributors
    • Funding
    • Ordering
  • News
    • 2023 News
    • 2022 ARCHIVE
    • 2021 ARCHIVE
    • 2020 ARCHIVE
    • 2019 ARCHIVE
    • 2018 ARCHIVE
    • 2017 ARCHIVE
    • 2016 ARCHIVE
    • 2015 ARCHIVE
    • 2014 ARCHIVE
    • 2013 ARCHIVE
    • 2012 ARCHIVE
    • 2011 ARCHIVE
    • ARCHIVE PRE 2011

Recombinant Human MAP2 Projection Domain #3
PROT-r-MAP2-P3

$120.00 – $800.00Price range: $120.00 through $800.00

Clear
SKU: prot-r-map2-p3 Category: Rat, not Mouse
  • Background
  • References

Microtubule associated protein 2 or MAP2 is a major microtubule binding protein of neurons, where it is concentrated in dendrites and perikarya but absent from axons (1). There is a single mammalian MAP2 gene which may generate multiple lower molecular weight forms usually named MAP2C and MAP2D which run on SDS-PAGE gels at 60-70kDa, though are actually much smaller in molecular size. These forms are found early in development but as the animal matures are replaced by MAP2A and B which are much larger in molecular size. These two forms include the so-called projection domain, a long insert which results in both molecules running at ~240kDa on SDS-PAGE gels. All four forms contain an N-terminal region which includes a binding site of cAMP dependent protein kinase (1). We have expressed five different recombinant forms of MAP2 based on the human sequence reported in REFSEQ XP_006712595.. These constructs in combination cover almost the entire human MAP2 molecule. We have used these constructs to generate a series of monoclonal and polyclonal antibodies to MAP2, many of which are known to recognize defined segments of MAP2.

We inserted cDNAs encoding the various MAP2 sequences into the pET29a eukaryotic expression vector. The vector adds an C-terminal His-tag which was use to purify the protein and this, along with some other vector derived sequence, adds about 5 kDa to the molecule.

The sequence is amino acids 1137-1538 from REFSEQ XP_006712595. This corresponds to the the third segment of the “projection domain” found in MAP2A and MAP2B but missing from MAP2C and MAP2D. The construct was expressed in pET29a and has a few N and C-terminal amino acids derived from the vector, including a C-terminal His-tag.

>MAP2-P3
SSKAPQEADAFMGVESGHMKEGTKVSETEVKEKVAKPDLVHQEAVDKEESYESSGEHESL
TMESLKADEGKKETSPESSLIQDEIAVKLSVEIPCPPAVSEADLATDERADVQMEFIQGP
KEESKETPDISITPSDVAEPLHETIVSEPAEIQSEEEEIEAQGEYDKLLFRSDTLQITDL
GVSGAREEFVETCPSEHKGVIESVVTIEDDFITVVQTTTDEGESGSHSVRFAALEQPEVE
RRPSPHDEEEFEVEEAAEAQAEPKDGSPEAPASPEREEVALSEYKTETYDDYKDETTIDD
SIMDADSLWVDTQDDDRSIMTEQLETIPKEEKAEKEARRSSLEKHRKEKPFKTGRGRIST
PERKVAKKEPSTVSRDEVRRKKAVYKKAELAKKTEVQAHSPSRKFILKPAIKYTRPTHLS
CVKRKTTAAGGESALAPSVFKQAKDKVS

1. Dehmelt1, H and Halpain, S. The MAP2/Tau family of microtubule-associated proteins.
Genome Biol. 204 (2005)

Related products

  • Recombinant Human MAP2 Projection Domain #2
    PROT-r-MAP2-P2

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • α-Synuclein, Cat# Prot-r-a-Syn

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Mouse Monoclonal Antibody to HSP27
    Cat# MCA-6H11

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Green Fluorescent Protein FP506

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page

Contact info

EnCor Biotechnology Inc.
4949 SW 41st Boulevard, Ste 40
Gainesville
Florida 32608 USA

Phone: (352) 372 7022
Fax: (352) 372 7066
E-mail: [email protected]

Recently Viewed Products

  • Mouse Monoclonal Antibody to Neurofilament NF-L <br>Cat# MCA-7D1 Mouse Monoclonal Antibody to Neurofilament NF-L
    Cat# MCA-7D1
    $120.00 – $800.00Price range: $120.00 through $800.00
  • Mouse Monoclonal Antibody to mCherry <br>Cat# MCA-5A6 Mouse Monoclonal Antibody to mCherry
    Cat# MCA-5A6
    $120.00 – $800.00Price range: $120.00 through $800.00
  • Mouse Monoclonal Antibody to Complement C3 α-chain <br>Cat# MCA-6E8 Mouse Monoclonal Antibody to Complement C3 α-chain
    Cat# MCA-6E8
    $120.00 – $800.00Price range: $120.00 through $800.00

Cart

RSS News

© Copyright - EnCor Biotechnology 2023.
  • Facebook
  • Rss
  • Linkedin
  • Twitter
Recombinant Human MAP2 Projection Domain #2
PROT-r-MAP2-P2
MAP2C Protein
Scroll to top