• 0Shopping Cart
EnCor Biotechnology
  • Home
  • About
    • Story of EnCor
    • Our Philosophy
    • Location
    • Jobs
  • Our Products
    • Mouse Monoclonal Antibodies
    • Rabbit Polyclonal Antibodies
    • Chicken Polyclonal Antibodies
    • Epitope Mapped Antibodies
    • Goat Polyclonal Antibodies
    • IHC Verified Antibodies
    • ELISA Kits
    • Pure Proteins
    • Posters
  • Links
    • On-Line Data
    • Poster Gallery
    • Programs
    • Protocols
    • Collaborators
    • Catalog Download
    • Distributors
    • Funding
    • Ordering
  • News
    • 2023 News
    • 2022 ARCHIVE
    • 2021 ARCHIVE
    • 2020 ARCHIVE
    • 2019 ARCHIVE
    • 2018 ARCHIVE
    • 2017 ARCHIVE
    • 2016 ARCHIVE
    • 2015 ARCHIVE
    • 2014 ARCHIVE
    • 2013 ARCHIVE
    • 2012 ARCHIVE
    • 2011 ARCHIVE
    • ARCHIVE PRE 2011

Western blot analysis of 0.25g of different recombinant proteins solutions expressed in pET family vectors and which contain the S-tag sequence (KETAAAKFERQHMDS), using mouse mAb MCA-1B63, dilution 1:5,000 in green: [1] protein standard (red), [2] aldolase A, [2] MBP, [4] MAP2, P2 projection domain construct and [5] FOX2-C terminal part of the protein. The antibody MCA-1B63 binds to the S-tag present in all tested recombinant proteins, and reveals protein bands of the expected molecular weights.

Western blot analysis of bovine pancreas tissue lysate using mouse mAb to S-tag protein, MCA-1B63, dilution 1:2,000 in green: [1] protein standard (red), [2] 40µg of bovine pancreas extract. A strong band at about 15kDa corresponds to S-tag sequence found in bovine pancreatic RNase 1.

Mouse Monoclonal Antibody to S-Tag
Cat# MCA-1B63

$120.00 – $800.00Price range: $120.00 through $800.00

      The story behind the S-tag is quite an interesting one. In the early days of biochemical research it was only feasible to purify and study naturally abundant proteins, so the earliest well characterized proteins were mostly either cytoplasmic enzymes or other abundant proteins such as for example hemoglobin and insulin. In 1958 Frederic M. Richardson showed that an RNAase activity secreted by bovine pancreas could be cleaved by the proteolytic enzyme subtilisin to produce two fragments which he named RNase-S-pep and RNase-S-prot. If the two fragments were separated the RNase activity almost vanished, but activity could be reconstituted if the two components were recombined (1). This interaction was regarded as a model system to study control of enzyme activity, receptor-ligand coupling, allosteric regulation and other forms of biologically important protein-protein interaction. The RNase-S-pep fragment proved to be the N-terminal 20 amino acids of the secreted form of the enzyme while the RNase-S-prot was the C-terminal 104 amino acids. Only the first 15 amino acids of the RNase-s-pep were necessary for the activation of the RNase-S-prot and this peptide became known as the S-tag. The S-tag is one of many intrinsically unstructured peptides which only adopts a defined structure on binding to a structured substrate. The S-tag is incorporated into many vectors including the pET29 and 30 series, pCITE-3 and pCITE-4. The S-tag sequence was incorporated into many expression systems and is detectable with certain antibody reagents allowing researchers to check the size and correct expression of recombinant proteins. Proteins including the S-tag can be purified using a column to which is bound the RNAse-S-prot (2). The modern nomenclature for the enzyme is RNAase A or RNAse 1.
      The MCA-1B63 antibody was made against a synthetic 53 amino acid peptide which is the sequence included in pET30a(+) and other vectors, See the “additional info” tab for further information about this peptide. A C-terminal cysteine was added to allow coupling to maleate activated KLH which was used as the immunogen. Numerous clones were screened by their ability to bind the immunogen and then re-screened for inhibition of this binding by the S-tag peptide. The bovine S-tag sequence is not well conserved across species boundaries, so this antibody is not likely to useful as a general marker for RNAase-1 from other species. Mouse select image above left for larger view.

Clear
SKU: mca-1b63 Categories: Epitope Mapped Antibodies, Mouse Monoclonal Antibodies, Peptide Antibody
  • Overview
  • Additional Info
  • References
  • Data Sheets
Name: Mouse monoclonal antibody to S-tag peptide from bovine pancreatic RNase A
Immunogen: Peptide derived from the N-terminal sequence of pET30a(+), MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEFC
HGNC Name: NA
UniProt: P61823
Molecular Weight: Not applicable
Host: Mouse
Isotype: IgG1
Species Cross-Reactivity: Cow
RRID: AB_2923481
Format: Purified antibody at 1mg/mL in 50% PBS, 50% glycerol plus 5mM NaN3
Applications: WB, ICC/IF
Recommended Dilutions: WB: 1:2,000-1:5,000. ICC/IF: not applicable
Storage: Shipped on ice. Store at 4°C for short term, for longer term at -20°C. Avoid freeze / thaw cycles.

This sequence includes a His-tag (gray and underlined), a thrombin cleavage site (blue), an S-tag affinity peptide (red), and an enterokinase cleavage site (green). The C-terminal cysteine was added to allow coupling to maleate activated KLH, while the previous two are encoded by an EcoRI site, often used to insert constructs into these vectors.

MHHHHHHSSGLVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGSEFC

1. Richards FM. On the enzymic activity of subtilisin-modified ribonuclease. PNAS 44:162-6 (1958).

2. Raines RT, McCormick M, Van Oosbree TR, Mierendorf RC. The S.Tag fusion system for protein purification Methods Enzymol. 326:362-76 (2000)

Download Datasheet PDFMSDS Datasheet PDF

Related products

  • Mouse select for larger image

    Mouse Monoclonal Antibody to β-tubulin
    Cat# MCA-1B12

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Mouse Monoclonal Antibody to Peripherin
    Cat# MCA-7C5

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Mouse Monoclonal Antibody to Neurofilament NF-M
    Cat# MCA-3H11

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page
  • Mouse Monoclonal Antibody to TAF15
    Cat# MCA-4D71

    $120.00 – $800.00Price range: $120.00 through $800.00
    Select options This product has multiple variants. The options may be chosen on the product page

Contact info

EnCor Biotechnology Inc.
4949 SW 41st Boulevard, Ste 40
Gainesville
Florida 32608 USA

Phone: (352) 372 7022
Fax: (352) 372 7066
E-mail: [email protected]

Recently Viewed Products

  • Chicken Polyclonal Antibody to NSE <br>Cat# CPCA-NSE Chicken Polyclonal Antibody to NSE
    Cat# CPCA-NSE
    $120.00 – $800.00Price range: $120.00 through $800.00
  • Chicken Polyclonal Antibody to GFAP <br>Cat# CPCA-GFAP Chicken Polyclonal Antibody to GFAP
    Cat# CPCA-GFAP
    $120.00 – $800.00Price range: $120.00 through $800.00

Cart

RSS News

© Copyright - EnCor Biotechnology 2023.
  • Facebook
  • Rss
  • Linkedin
  • Twitter
Human β-Synuclein Protein, Cat# Prot-r-SNCB Human γ-Synuclein Protein, Cat# Prot-r-SNCG
Scroll to top